PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010546107.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family LFY
Protein Properties Length: 397aa    MW: 43891.3 Da    PI: 7.9762
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010546107.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY589.57.8e-18063739386
         FLO_LFY   9 slfkwd.praaaaapparlleeaavseap.leaaaaaaarklr..eleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrl 99 
                      lf+wd +r++a++pp rl +   +++++  ++aaa+aa  lr  +le l+ ayG+ry+t+akiaelGft+stLv+mk+eeldd+m+sl++ifr+
  XP_010546107.1   6 CLFRWDpTRTMAQPPPGRLPPPPPQQPPQsPATAAAVAAFGLRlgGLEGLLGAYGIRYYTAAKIAELGFTASTLVGMKEEELDDMMNSLCHIFRW 100
                     58****555666777777765544433332233333333334455************************************************** PP

         FLO_LFY 100 dllvGeryGikaavraerrrleeeeae.kkrrkll.......sedeet.aldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeek 185
                     +llvGeryGikaa+raerrrl+eee++ ++rr+++       + d+ t   dalsqeglseepvq+ek+ a++gg+        a+     ++++
  XP_010546107.1 101 ELLVGERYGIKAAIRAERRRLQEEEDDaSRRRHFFlsstaapAGDSGThPHDALSQEGLSEEPVQQEKDPAVNGGGA-------AS-----SASR 183
                     *********************996654155566445777777556655599***************99998887777.......11.....1222 PP

         FLO_LFY 186 kkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtk 280
                     kk+   +++rkk +e           eed  +++  + g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq++ak+rGekcP+k
  XP_010546107.1 184 KKQ---QRRRKKPEE--------AGAEEDAGDDDVDDVGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQSLAKDRGEKCPSK 267
                     333...233333333........33445555666777899******************************************************* PP

         FLO_LFY 281 vtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLr 375
                     vtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaia r+gwdidavfnahprLsiWYvPtkLr
  XP_010546107.1 268 VTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGAWRQACYKPLVAIAGRRGWDIDAVFNAHPRLSIWYVPTKLR 362
                     *********************************************************************************************** PP

         FLO_LFY 376 qLChlerskas 386
                     qLCh+ers+a+
  XP_010546107.1 363 QLCHAERSNAV 373
                     ********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.7E-1882372IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MDPEGCLFRW DPTRTMAQPP PGRLPPPPPQ QPPQSPATAA AVAAFGLRLG GLEGLLGAYG  60
IRYYTAAKIA ELGFTASTLV GMKEEELDDM MNSLCHIFRW ELLVGERYGI KAAIRAERRR  120
LQEEEDDASR RRHFFLSSTA APAGDSGTHP HDALSQEGLS EEPVQQEKDP AVNGGGAASS  180
ASRKKQQRRR KKPEEAGAEE DAGDDDVDDV GTERQREHPF IVTEPGEVAR GKKNGLDYLF  240
HLYEQCREFL LQVQSLAKDR GEKCPSKVTN QVFRYAKKSG ASYINKPKMR HYVHCYALHC  300
LDEEASNALR RAFKERGENV GAWRQACYKP LVAIAGRRGW DIDAVFNAHP RLSIWYVPTK  360
LRQLCHAERS NAVAAAAFGG CGSGGSSASG HSEQLRY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1152103901183PROTEIN LEAFY
2vy2_A1e-1152103901183PROTEIN LEAFY
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010546107.10.0PREDICTED: protein LEAFY-like
SwissprotQ009581e-174LFY_ARATH; Protein LEAFY
TrEMBLM1L3050.0M1L305_9R
STRINGBra029305.1-P1e-179(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-110floral meristem identity control protein LEAFY (LFY)